Target protein sequence
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGAR
Stability
Activity
Solubility
Trusted by labs at 5,000+ organizations across 50+ countries
Proudly used by top companies and institutions globally
Preserved activity
Enhanced thermostability
Enhanced pH Stability
49-56% sequence identity to WT
High expression in E. coli
Diverse catalytic sites
Start with data or from scratch
Seamlessly import assay data from a current project, or kick off a new initiative by starting fresh with just a single initial sequence.
Predictable lab outcomes
Every generated sequence is accompanied by a predicted performance score. While it may lack surprises, it boosts productivity for all.
Reach milestones faster
NeuroFold learns more with every experimental round leading to improved variants each time and significantly reducing your time-to-market.
Effortless Multi-Property Optimization
With NeuroFold, effortlessly optimize multiple properties simultaneously. Save time with a true one stop shop for enzyme optimization.
Security & privacy
Your proteins, sequences, experimental data, and privately trained models remain accessible only to your team.
Platform controls protect sensitive protein engineering data throughout every optimization round.
Your variants, results, models, and intellectual property remain yours. No royalties or equity.
Our team supports assay definition, onboarding, and integration into your existing research workflow.
Build the next variant
Bring NeuroFold into your protein engineering workflow with support from our scientific team.